🔴 Only For Medical Professionals 🔴

Thymosin Beta 4 | Amber Edition

A provider account is required to view prices and to place orders.

HYMOSINHYYHHThymosin Beta Peptide is a 43-amino acid polypeptide that functions primarily as a G-actin sequestering molecule, regulating actin polymerization by binding monomeric actin in a 1:1 stoichiometric ratio. This sequestration maintains the intracellular pool of unpolymerized actin and modulates cytoskeletal organization, indirectly influencing processes such as cell migration and adhesion through its control over actin filament dynamics. It is involved in actin treadmilling by interacting with actin-associated proteins such as profilin and cofilin. It plays a role in controlling the availability of actin for the Arp2/3 complex and formins.

Thymosin Beta-4 activity is linked to the regulation of Rho family GTPases, including RhoA, Rac1, and Cdc42, which coordinate cytoskeletal reorganization, lamellipodia, and filopodia extension. It also indirectly impacts PI3K/Akt and MAPK/ERK signaling cascades via feedback from focal adhesion and cytoskeletal tension pathways. Nuclear localization has been observed under certain experimental conditions, suggesting possible involvement in chromatin accessibility or transcriptional regulation, although this function remains incompletely characterized.

The peptide exhibits redox sensitivity due to the presence of methionine and cysteine residues, which can undergo oxidative modifications that alter its binding behavior and functional activity. Protein interactions beyond actin include potential binding to scaffolding proteins involved in integrin-linked kinase complexes and 14-3-3 domains, depending on the cellular context and phosphorylation state.i

Unit Size 10 mg/vial
Unit Quantity 1 Amber Vial
Molecular Formula C38H68N10O14
Molecular Weight 4963 Da
Sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Appearance White Powder
Peptide Purity >98.1%
Solubility Soluble in water or 1% acetic acid

Safety Disclaimer

The products offered on this website are furnished for in-vitro studies (Latin:in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.