LL-37 (CAP-18)
LL-37, a 37-amino-acid cathelicidin peptide, exhibits antimicrobial and immunomodulatory effects by disrupting bacterial membranes and modulating immune responses through receptors like FPRL1 and TLRs. It promotes wound healing, angiogenesis, and cytokine release while suppressing excessive inflammation, making it a candidate for treating infections, chronic wounds, and inflammatory disorders.
Brand: Cell Energix
| Unit Size | 5 mg/ vials |
| Unit Quantity | 1 Amber Vials |
| Molecular Formula | C215H350N62O71 |
| Molecular Weight | 4493.11 |
| Sequence | [LL-37, 37 aa] |
| Appearance | White Powder |
| Peptide Purity | >98.1% |
| Solubility | Soluble in water or 1% acetic acid |
The products offered on this website are furnished for in-vitro studies (Latin:in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.
